Aeromicrobium duanguangcaii: NP095_11625 Help Entry NP095_11625       CDS       T09547                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism adb  Aeromicrobium duanguangcaii Brite KEGG Orthology (KO) [BR:adb00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     NP095_11625 Enzymes [BR:adb01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      NP095_11625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Thioredoxin Glrx-like GST_N_3 DUF3088 Motif Other DBs NCBI-ProteinID:  UUI67843 LinkDB All DBs Position 2347713..2347958 Genome browser AA seq 81 aa AA seqDB search MSDASFVMYSTPWCGYCHRLKSQLKREGITFDEVDIEQQPEAAQIVEKANGGNQTVPTLV FADGTALTNPSVAQVKAQLGL NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgcatcgttcgtcatgtactccacgccgtggtgcggctactgccatcgcctc aagtcgcagctcaagcgcgagggcatcacgttcgacgaggtcgacatcgagcagcagccc gaggccgcccagatcgtcgagaaggccaacggcggcaaccagacggtgccgacgctggtc ttcgccgacggcacggccctgacgaacccgtcggtcgcgcaggtcaaggcgcagctcggt ctctga

DBGET integrated database retrieval system