Anaeromyxobacter dehalogenans 2CP-C: Adeh_0180 Help Entry Adeh_0180         CDS       T00326                                  Name (GenBank) Histidine triad (HIT) protein   KO K02503   histidine triad (HIT) family protein [EC:3.9.1.-] Organism ade  Anaeromyxobacter dehalogenans 2CP-C Brite KEGG Orthology (KO) [BR:ade00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:ade03016]     Adeh_0180   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ade04147]     Adeh_0180 Transfer RNA biogenesis [BR:ade03016]  Eukaryotic type   Aminoacyl-tRNA synthetases (AARSs)    AARS associated factors     Adeh_0180 Exosome [BR:ade04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Adeh_0180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIT DcpS_C SBP56 Motif Other DBs NCBI-ProteinID:  ABC79957 UniProt:  Q2IMC4 LinkDB All DBs Position 209673..210017 Genome browser AA seq 114 aa AA seqDB search MSDCLFCKIARGELPAKLVHQDADTVAFVDVNPQAPTHLLVIPRKHIPTVNDLSAEDEAL MGKLYRVAAALAKERGVDGSGWRAVVNTHGDAGQTVFHVHLHLLGGRRMAWPPG NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcgactgcctgttctgcaagatcgcgcggggcgagctccccgccaagctggtgcac caggacgccgacacggtggcgttcgtggacgtcaacccgcaggcgcccacgcacctgctg gtcatcccgcgcaagcacatccccaccgtgaacgacctctccgccgaggacgaggcgctc atggggaagctgtaccgggtggcggcggcgctcgcgaaggagcgcggggtggacgggtcc ggctggcgcgccgtcgtgaacacgcacggcgacgcggggcagaccgtgttccacgtccac ctgcacctgctcggcggccgccgcatggcctggcccccgggctag

DBGET integrated database retrieval system