Acropora digitifera (stony coral): 107333906 Help Entry 107333906         CDS       T04352                                  Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism adf  Acropora digitifera (stony coral) Pathway adf04814   Motor proteins Brite KEGG Orthology (KO) [BR:adf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107333906  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:adf03037]     107333906    04812 Cytoskeleton proteins [BR:adf04812]     107333906 Cilium and associated proteins [BR:adf03037]  Motile cilia and associated proteins   Dynein arm    107333906 Cytoskeleton proteins [BR:adf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      107333906 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 PTP2 Motif Other DBs NCBI-GeneID:  107333906 NCBI-ProteinID:  XP_015754259 LinkDB All DBs Position Un AA seq 113 aa AA seqDB search MDEFQGAEETSFVVDEVSNIIKESVEGAIGGNAYQHNKVNQWTSNVVEQCLNQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNTSDGSCTVRWENKTMYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagtttcaaggcgcagaagaaacatccttcgtcgtagatgaagtgagcaacatc ataaaagaatccgttgagggagcaatcggtggaaacgcctaccaacataacaaagtgaac cagtggacgtcaaatgtggtggaacagtgcttgaaccagcttacaaagcttggcaaaccg ttcaagtacatcgtcacctgtgtcatcatgcagaaaaatggagcaggccttcacactgct agttcttgcttttgggataatacttcggatggcagttgcacagtgagatgggaaaacaag accatgtattgcatcgtgagcgtgtttggcttggcgatttga

DBGET integrated database retrieval system