Acropora digitifera (stony coral): 107340501 Help Entry 107340501         CDS       T04352                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism adf  Acropora digitifera (stony coral) Pathway adf03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:adf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     107340501  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:adf03036]     107340501   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:adf04147]     107340501 Chromosome and associated proteins [BR:adf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107340501 Exosome [BR:adf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107340501 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF LPP Motif Other DBs NCBI-GeneID:  107340501 NCBI-ProteinID:  XP_015761341 LinkDB All DBs Position Un AA seq 120 aa AA seqDB search MAGSARKKSERTAPINRSLRAGVVFRVGRINSRLHKGKYATRISQGTPVYLAAALEYLTA EVLELAGNAARANNRIRITPCHITLAVRGDEELNELLANVTITEGGVVPNIQSVLLPKKH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggccggtagtgcccgaaaaaaaagcgagagaactgcaccgataaaccgctcattaaga gcgggcgttgtatttcgcgtgggacgtatcaacagtcgtcttcacaaaggcaaatatgca acgcgtattagccaaggcactcctgtctacttggctgctgcacttgaatacctcaccgct gaggtcttggagttggcgggtaacgccgctcgcgccaacaacagaatcagaatcactccc tgccacattacccttgctgtgcgcggtgacgaggagttgaacgaactgcttgccaacgtt accatcacggaaggaggtgtggtaccaaatatccaatctgtccttcttcccaagaaacac taa

DBGET integrated database retrieval system