KEGG   Acropora digitifera (stony coral): 107341807
Entry
107341807         CDS       T04352                                 

Definition
(RefSeq) stress-activated protein kinase JNK-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04068  FoxO signaling pathway
adf04137  Mitophagy - animal
adf04140  Autophagy - animal
adf04141  Protein processing in endoplasmic reticulum
adf04215  Apoptosis - multiple species
adf04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:adf00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107341807
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107341807
   04068 FoxO signaling pathway
    107341807
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107341807
   04137 Mitophagy - animal
    107341807
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107341807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:adf01001]
    107341807
Enzymes [BR:adf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107341807
Protein kinases [BR:adf01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107341807
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo Kinase-like APH RIO1 YrbL-PhoP_reg Trm5_N
Other DBs
NCBI-GeneID: 107341807
NCBI-ProteinID: XP_015762762
LinkDB
Position
Un
AA seq 441 aa
MFRCCELIPCFCRAIDKLVLGDKSDGGLKNIPNLSADMFYSVQVGDTIFTVLKRYRNLQP
IGSGAQGMVCSALDTVTGEKVAIKKLCRPFQNVTHAKRAFRELVLLKMVNHKNIIGLLNV
FTPDRSFEEFQDLYLVTELMDASLVQVIQMDLDHERLSYLMYQMLCGVKHLHDAGIIHRD
LKPSNIVVKSDCSLKILDFGLARTAGAAFMMTPYVVTRYYRAPEVILGMGYSENVDVWSI
GCILGEMIRGSVMFPGTDHIDQWNKVTELLGTPSESFLNQLQPSVRMYCSSRPKQPGFSF
EALFPDDSFPPGNKKKAEECRDLLSKMLVVDRSKRISVIDALDHPYIHVWYEKSEVESTV
PSKYDPSVDEKDHTVEEWKRTIYQEVMSYNNLSEISSPVEGNGEINQSSSSSSTSSGSLY
FVLLLQTVLQKSIQDFAHIGN
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtttaggtgttgtgaactaattccttgcttttgtagggctatagacaagctcgtttta
ggagataaaagtgatggtggattgaagaatattcctaatttatctgcggatatgttttat
tctgtacaagttggtgacaccatttttacggtgttgaagcggtaccgaaatttacaacct
attggttccggcgcccaaggaatggtttgttctgccttagatactgtgactggggaaaag
gtagccatcaagaagctgtgtcgaccatttcaaaatgtcactcatgccaaaagagccttc
agggaattggtgttgttaaaaatggttaatcacaaaaatattataggtcttctgaatgtt
ttcactcctgatagatcatttgaagagtttcaagacttatatcttgtaacagagttaatg
gatgccagcttagttcaagtgattcaaatggatttggaccatgagcggctttcttattta
atgtatcagatgttgtgtggtgttaagcaccttcatgatgcaggcatcattcatagggac
cttaagccaagtaatatcgtagtgaaatcagactgttcattaaagatactggattttggc
ctggcgcgcacagcaggtgcagccttcatgatgactccttatgttgtaacacggtattac
agggcaccagaggttatccttggaatgggttacagcgagaacgtggatgtctggtccatt
ggctgtatactgggcgaaatgatccgaggcagtgttatgtttccaggcactgatcacatt
gatcaatggaataaagtaaccgaacttcttggtacaccatcagaatcgtttttaaatcag
ctgcaaccgtcggtgaggatgtactgctctagtcgaccaaagcagccagggttcagcttt
gaggcactgtttccagacgactcttttccaccaggaaacaagaagaaagctgaagaatgt
cgtgaccttctttctaaaatgttggtggttgatcggtcgaaacggatctctgtgatcgac
gccttagaccatccttacatacacgtgtggtatgagaaaagcgaagtggaatctactgtt
cctagtaaatatgacccatcagtcgatgaaaaagaccacactgttgaagagtggaaacgt
acaatttatcaggaagttatgtcttacaacaatttgagcgaaatatcatctccagtcgaa
ggaaatggagaaatcaatcagtcatcttcgagttcaagtacttcgtcaggttcgttatat
tttgttcttctgcttcaaactgttttgcaaaaatctattcaagactttgcacacatcggc
aattag

DBGET integrated database retrieval system