KEGG   Acropora digitifera (stony coral): 107350075
Entry
107350075         CDS       T04352                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5-like
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
adf  Acropora digitifera (stony coral)
Pathway
adf04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:adf00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    107350075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:adf01002]
    107350075
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:adf03036]
    107350075
Peptidases and inhibitors [BR:adf01002]
 Peptidase inhibitors
  Family I32: IAP family
   107350075
Chromosome and associated proteins [BR:adf03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     107350075
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    107350075
SSDB
Motif
Pfam: BIR zf-C3HC
Other DBs
NCBI-GeneID: 107350075
NCBI-ProteinID: XP_015771784
LinkDB
Position
Un
AA seq 140 aa
MAEGLFYDFNMNRLENRLATFQDWPFTEETGSSCTATKMAEAGFYHSSNDRDPDIARCFV
CFKELEGWEPDDNPWEEHKSHSAKCEFLLLNKKEEDWTVEDFLELETKRQINRMQKIIEL
KVKEYSEVAQHVQTEMGKLV
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccgaaggattattctatgattttaacatgaaccgactcgaaaatcggctagctaca
ttccaggattggccttttactgaggagactggttctagttgtacagcaacgaagatggca
gaggcaggcttctatcattcttccaatgatcgcgatccagacattgctcgctgctttgtt
tgtttcaaagaacttgaaggatgggaacctgatgataatccctgggaagaacacaaatcc
cattcagccaaatgtgaattccttttattgaataaaaaggaagaagactggacagtagaa
gacttcttggaactggaaaccaaaagacaaatcaacagaatgcaaaagatcatcgaactg
aaggtcaaagaatactctgaggttgcccagcatgttcaaactgaaatgggaaaacttgtc
tga

DBGET integrated database retrieval system