Ammonifex degensii: Adeg_1283
Help
Entry
Adeg_1283 CDS
T00994
Name
(GenBank) acetyl-CoA carboxylase, biotin carboxylase
KO
K01961
acetyl-CoA carboxylase, biotin carboxylase subunit [EC:
6.4.1.2
6.3.4.14
]
Organism
adg
Ammonifex degensii
Pathway
adg00061
Fatty acid biosynthesis
adg00620
Pyruvate metabolism
adg00640
Propanoate metabolism
adg00720
Other carbon fixation pathways
adg01100
Metabolic pathways
adg01110
Biosynthesis of secondary metabolites
adg01120
Microbial metabolism in diverse environments
adg01200
Carbon metabolism
adg01212
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:
adg00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00620 Pyruvate metabolism
Adeg_1283
00640 Propanoate metabolism
Adeg_1283
09102 Energy metabolism
00720 Other carbon fixation pathways
Adeg_1283
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Adeg_1283
Enzymes [BR:
adg01000
]
6. Ligases
6.3 Forming carbon-nitrogen bonds
6.3.4 Other carbon-nitrogen ligases
6.3.4.14 biotin carboxylase
Adeg_1283
6.4 Forming carbon-carbon bonds
6.4.1 Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
6.4.1.2 acetyl-CoA carboxylase
Adeg_1283
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CPSase_L_D2
Biotin_carb_N
Biotin_carb_C
Dala_Dala_lig_C
ATP-grasp
RimK
ATP-grasp_4
GARS_A
ATP-grasp_5
DUF3182
LAL_C2
ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID:
ACX52393
UniProt:
C9R7W4
LinkDB
All DBs
Position
complement(1287830..1289176)
Genome browser
AA seq
448 aa
AA seq
DB search
MFRKVLIANRGEIALRIIRACRELGIKTVVVYSEADRESLPVRLADEAVCIGPPPASQSY
LNITNILSAAEVTGADAIHPGYGFLAENASFAEICSTCGLTFIGPPVEALEKMGSKALAR
KTVAAAGVPVVPGSEEVITDVKEALRLAAELGYPVLIKASAGGGGRGMRVVHTPAELEKA
LAAAQSEAEAAFGSPEVYLEKYLEEPRHIEFQIVGDKYGNLIYLGERDCSIQRRNQKLLE
ESPSVALTPELRRRMGEAAVKAAQAVGYHNVGTVEFLLDKHGNFYFIEMNTRIQVEHPVT
EMVTGWDLVKEQIKLAAGERLACRQEDVKLTGWAIECRINAEDPERQFAPCPGRITAYLP
PGGPGIRVDSAVYPGYEIPPYYDSLIAKLIAWGRDREEAIARAERALEEFVIEGISTTIP
FHLKVLRNAFFRRGEVYTNFVQRRILGE
NT seq
1347 nt
NT seq
+upstream
nt +downstream
nt
atgttcaggaaggtactcatcgccaatcggggagaaatcgcgctgcgcataataagggcc
tgccgcgagctgggaataaagacggtggtggtctattccgaggcggatcgcgagagcttg
ccggttcggctggccgacgaagcggtatgcatcggccccccaccggccagccaaagctac
ctcaacatcactaacatcctgagcgccgccgaggtaaccggggcggacgccatccatccg
ggctacgggtttttagcagaaaacgccagctttgccgagatatgctccacctgcgggctt
accttcatcggcccgccggtagaagccctggagaagatgggctccaaggccctggcccgc
aagacggtggcggcggcaggtgtcccggtggttcccggatcggaggaggtcataaccgac
gtaaaggaggccctgcggctggcggcagagctcggctacccggtactcataaaggcctcg
gctggtggcggcggacgggggatgcgggtggtgcacacgccagcggagctagaaaaggcc
ctggccgcagcccagtcggaggcggaagcggcctttggtagccccgaggtctacctggag
aagtacttggaagagccccgccatatcgagtttcagatagtgggggacaagtacggcaac
ctaatttacctgggggagcgcgactgctccattcaaaggcgcaaccagaagctattggag
gagtccccgtcggtggccttgactcctgagttgcgccggcggatgggggaagcggcggtg
aaggcggcgcaagcggtgggctaccacaacgtgggaacggtggagttcctgctggacaag
cacggcaatttctacttcatcgaaatgaatacccgtatccaggtggagcacccggtgacc
gagatggtcaccggctgggacctggttaaggagcagataaagctggcggccggagaacgt
ctggcatgccgccaggaggacgtgaaactcacgggctgggccatcgagtgccgcataaat
gctgaagacccggagcggcaattcgccccctgcccggggcgcatcaccgcctatcttcct
cccggggggccgggtatccgggtggacagtgccgtttaccctggatacgaaattcctccc
tactatgactcgctcattgccaagctcatcgcctggggacgtgaccgggaggaagctatt
gcccgggctgaaagggccctggaggaatttgtcatcgaaggaataagcacgaccattcct
tttcaccttaaggttctacgcaatgctttctttaggcggggagaagtctatactaacttc
gtacaaaggcgaattctaggggaataa
DBGET
integrated database retrieval system