Aeromonas dhakensis: CK627_08740 Help Entry CK627_08740       CDS       T05186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism adh  Aeromonas dhakensis Pathway adh01100   Metabolic pathways adh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK627_08740    00074 Mycolic acid biosynthesis     CK627_08740   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK627_08740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASX10858 LinkDB All DBs Position 1772606..1772893 Genome browser AA seq 95 aa AA seqDB search MTAYGTVMQDLHLEIKQLIIDSLNLEGLTPDDIDSQAPLFGDGLGLDSIDALELGLAIKG RYGIVLSAEDENTRRHFASVAALVALVQAQSKGEA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgacagcatatggaacagttatgcaagacctgcatctagagataaaacaactcatcatc gacagcctcaacctcgaggggctcacccctgacgacatcgacagccaggccccgctgttt ggggacggcctggggctggactccatcgatgcgctggagctgggccttgccatcaagggt cgctacggcatcgtcctctccgccgaggatgagaacacccgtcgccactttgcctccgtt gcggccctggtggccctggtgcaggcccagtcgaaaggggaggcctga

DBGET integrated database retrieval system