Aeromonas dhakensis: CK627_08745 Help Entry CK627_08745       CDS       T05186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism adh  Aeromonas dhakensis Pathway adh01100   Metabolic pathways adh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK627_08745    00074 Mycolic acid biosynthesis     CK627_08745   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK627_08745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASX10859 LinkDB All DBs Position 1772897..1773145 Genome browser AA seq 82 aa AA seqDB search MTRDDIFAQIKAALVELFEVDEEAITPEARLYQDLELDSIDAIDLVVHLQKLTGKKIKPE EFKSVRSVNDVVDAVERLLADA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgatatctttgcccagatcaaggccgccctcgtcgaactgttcgaagtc gacgaagaggccatcacccccgaggcccgcctctatcaggatctcgagctcgacagcata gacgccatcgatctggtggtgcacctgcagaagctgaccggcaagaagatcaagccggag gagttcaagtcggtgcgcagcgtcaacgacgtggtggatgcggtcgagcgtctgctggcc gacgcctga

DBGET integrated database retrieval system