Aeromonas dhakensis: CK627_15025 Help Entry CK627_15025       CDS       T05186                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism adh  Aeromonas dhakensis Pathway adh01100   Metabolic pathways adh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CK627_15025    00074 Mycolic acid biosynthesis     CK627_15025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CK627_15025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB EutQ HLH DUF7966 MAP Motif Other DBs NCBI-ProteinID:  ASX11998 LinkDB All DBs Position 3228504..3228740 Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcatcgaacaactgggtgttaaagaa gaagacgttaagaacgctgcctccttcgtcgacgacctgggcgctgactctttggatacc gttgaactggtaatggcgctggaagaagaattcgataccgaaattcctgatgaagaagcc gagaagatcaccactgttcaagcggctatcgactacatcaccgctaatcaggaataa

DBGET integrated database retrieval system