Alloalcanivorax dieselolei: B5T_02782 Help Entry B5T_02782         CDS       T02259                                  Name (GenBank) Putative tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism adi  Alloalcanivorax dieselolei Pathway adi00362   Benzoate degradation adi01100   Metabolic pathways adi01120   Microbial metabolism in diverse environments adi01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:adi00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     B5T_02782    00622 Xylene degradation     B5T_02782    00621 Dioxin degradation     B5T_02782 Enzymes [BR:adi01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      B5T_02782 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  AFT71050 UniProt:  K0CFA0 LinkDB All DBs Position 3085376..3085594 Genome browser AA seq 72 aa AA seqDB search MPFANYKFPEGILDHAKKEEIIHRTTAMFVEYFGEGVRPYSMVLVEEVADGGWGRADETL TLEKMGLPPKSR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgccgttcgctaattacaagttcccggaaggaattctggaccacgccaagaaggaagaa atcatccatcgcaccacggcaatgttcgtcgagtatttcggcgagggcgtccgcccgtac tcgatggttctggtcgaagaggttgccgatggcggctggggtcgtgccgacgagacgctg acgctagagaagatggggctgccacccaagtcgagatag

DBGET integrated database retrieval system