Alloacidobacterium dinghuense: H7849_22825 Help Entry H7849_22825       CDS       T08177                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism adin  Alloacidobacterium dinghuense Pathway adin01100   Metabolic pathways adin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H7849_22825 (acpP)    00074 Mycolic acid biosynthesis     H7849_22825 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H7849_22825 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QNI31835 UniProt:  A0A7G8BH15 LinkDB All DBs Position 5454449..5454694 Genome browser AA seq 81 aa AA seqDB search MAAVEDKVKQIIVEQLQVDEAEVTPSASFQEDLGADSLDVVELVMQFEEAFDLEIPDEDA EKIKTVKDAIDYIEKNAKGGK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtggaagataaagtaaagcagatcatcgtcgaacagcttcaggtcgacgaa gccgaagtgacgcccagcgcatcttttcaggaagatcttggcgccgattcgctcgacgta gtcgagcttgtaatgcaattcgaagaagccttcgatcttgagattcccgacgaagatgcc gaaaagatcaagacggtgaaggacgccatcgactatatcgagaagaacgcgaaaggcggc aagtag

DBGET integrated database retrieval system