KEGG   Azospirillum doebereinerae: ACIU1J_22345
Entry
ACIU1J_22345      CDS       T10877                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
adj  Azospirillum doebereinerae
Pathway
adj00430  Taurine and hypotaurine metabolism
adj00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:adj00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ACIU1J_22345 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    ACIU1J_22345 (tauD)
Enzymes [BR:adj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     ACIU1J_22345 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: XKH37100
LinkDB
Position
contig_3:complement(665447..666232)
AA seq 261 aa
MGGIDLARPLTAETAAELAALLVRHQVLFFENQPLTPAQQRAFAAGFGPLHVHPVYPSVP
DFPEIMVLDTGPHNPTDNDVWHTDVTFVEAPPAIVALSAKKVPPSGGDTVWSSAFAAYEA
LSEPLRRLLEPLHAVHDFTRSFPEWRHDKPGIRERWLEARAKNPARTHPVVRTHPVNGRK
ALFVNENFTAAILGLSPRESDGILRILFDHVARPEFTVRWQWKPDDLALWDNRSTQHYAV
NDYLPHSRLMHRATVLGDRPV
NT seq 786 nt   +upstreamnt  +downstreamnt
gtgggcgggatcgacctcgcccgcccgctgacggcggagaccgccgccgaactggcggcg
ctgctggtgcgccatcaggtgctgttcttcgagaaccagccgctgacgcccgcgcagcag
cgcgccttcgccgccggcttcgggccgctgcacgtccacccggtctatcccagcgtgccg
gattttccggaaatcatggtgctcgacaccgggccgcacaacccgaccgacaacgacgtc
tggcacaccgacgtgaccttcgtggaggcgccgccggccatcgtcgcgctgtcggccaag
aaagtcccgcccagcgggggcgacaccgtgtggagcagcgccttcgccgcctacgaggcg
ctgtcggagccgctgcgccgcctgctggagccgctgcacgcggtgcacgacttcacccgg
tccttcccggaatggcgccacgacaagccgggaatccgcgaacgctggctggaggcgcgg
gcgaagaacccggcgcgcacccatcccgtggtccgcacccacccggtgaacggccgcaag
gccctgttcgtgaacgagaacttcacggcggcgatccttggcctcagcccacgggaaagc
gacggcatcctgcgcatcctgttcgaccacgtcgcccgtccggaattcaccgtgcgctgg
cagtggaagccggacgatctggcgctgtgggacaaccggtcgacccagcattacgccgtg
aatgactacctgccgcacagccggctgatgcaccgcgccaccgtgctgggcgaccgcccg
gtgtag

DBGET integrated database retrieval system