Alicycliphilus denitrificans K601: Alide2_1264 Help Entry Alide2_1264       CDS       T01463                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism adk  Alicycliphilus denitrificans K601 Pathway adk01100   Metabolic pathways adk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Alide2_1264    00074 Mycolic acid biosynthesis     Alide2_1264   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Alide2_1264 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  AEB83668 UniProt:  F4GCY5 LinkDB All DBs Position 1326222..1326461 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgccgagcaactcggcgtggaagag tctcaagtcaccaacgaaaaggccttcgtggccgacctgggtgccgactcgctggacacg gtggagctggtgatggcgctggaagacgaattcggcatcgagatccctgacgaggacgca gagaagatcacgacagtgcagaacgccatcgactacgccaatacccatcagaaggcctaa

DBGET integrated database retrieval system