Auricularia subglabra: AURDEDRAFT_110715 Help Entry AURDEDRAFT_110715 CDS       T03129                                  Name (GenBank) RNA polymerase I   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism adl  Auricularia subglabra Pathway adl03020   RNA polymerase adl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:adl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     AURDEDRAFT_110715   09124 Replication and repair    03420 Nucleotide excision repair     AURDEDRAFT_110715  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:adl03021]     AURDEDRAFT_110715    03400 DNA repair and recombination proteins [BR:adl03400]     AURDEDRAFT_110715 Transcription machinery [BR:adl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      AURDEDRAFT_110715   RNA polymerase III system    RNA polymerase III      AURDEDRAFT_110715   RNA polymerase I system    RNA polymerase I      AURDEDRAFT_110715 DNA repair and recombination proteins [BR:adl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       AURDEDRAFT_110715 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-ProteinID:  EJD54089 JGI:  110715 LinkDB All DBs AA seq 145 aa AA seqDB search MNSSIVFDDLFKIQEVDQGGKKFDRVSRLAAHSSNLDMHLTLDYNSEIFPLHQDQSFTMA LATSLGAGGADDEQNSWRPDGRGSGGLDNEYEYVMYGKVYKFDEGSGENVTAYASFGGLL MALSGSFRHMQGIVLGDPIYLLIRR NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atgaactcgagcattgtctttgacgatctcttcaaaatccaagaggtagaccagggcggc aagaaattcgaccgcgtctcgcgtctcgcggcccactcgtccaacttggacatgcacctg acgctcgactacaactctgaaatcttcccgctgcaccaagatcagagcttcacgatggcg ctcgcgacgtccctgggcgctggcggcgcggacgacgagcaaaactcgtggcggccagac gggcgcggcagcggcgggctcgacaacgagtacgaatatgtcatgtatggcaaggtgtat aaattcgacgaagggtctggagaaaatgtcaccgcgtacgcgtcgttcggtggcctgctc atggctctgtctggctcgttccgacacatgcagggcatcgtgcttggcgaccccatttat ctgctcatccgacggtga

DBGET integrated database retrieval system