Auricularia subglabra: AURDEDRAFT_157172 Help Entry AURDEDRAFT_157172 CDS       T03129                                  Name (GenBank) secE/sec61-gamma protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism adl  Auricularia subglabra Pathway adl03060   Protein export adl04141   Protein processing in endoplasmic reticulum adl04145   Phagosome Brite KEGG Orthology (KO) [BR:adl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AURDEDRAFT_157172    04141 Protein processing in endoplasmic reticulum     AURDEDRAFT_157172  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     AURDEDRAFT_157172  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:adl04131]     AURDEDRAFT_157172   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:adl02044]     AURDEDRAFT_157172 Membrane trafficking [BR:adl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     AURDEDRAFT_157172 Secretion system [BR:adl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    AURDEDRAFT_157172 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE YBR126W-A CbtB Motif Other DBs NCBI-ProteinID:  EJD53920 JGI:  157172 LinkDB All DBs AA seq 70 aa AA seqDB search MAEKIREIVEIPREFIHDGKQFLARCTKPSQKEFTQICKAVALGFVVMGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggctgagaagattcgggaaatcgtcgagattccgcgcgagttcatccacgacggcaaa cagttcctcgctcgctgcacaaaaccgtcgcagaaggagttcacgcagatctgcaaggct gtcgctcttggtttcgtagtcatgggattcattgggtacttcgtcaagctcatacacatc cctatcaacaacatcctggtgggaggagcatag

DBGET integrated database retrieval system