Auricularia subglabra: AURDEDRAFT_41204 Help Entry AURDEDRAFT_41204  CDS       T03129                                  Name (GenBank) ubiquitin DRF-UBI   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism adl  Auricularia subglabra Pathway adl03010   Ribosome adl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:adl00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     AURDEDRAFT_41204   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     AURDEDRAFT_41204  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:adl03011]     AURDEDRAFT_41204    04121 Ubiquitin system [BR:adl04121]     AURDEDRAFT_41204 Ribosome [BR:adl03011]  Ribosomal proteins   Eukaryotes    Large subunit     AURDEDRAFT_41204   Archaea     AURDEDRAFT_41204 Ubiquitin system [BR:adl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    AURDEDRAFT_41204 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Ubiquitin_4 Rad60-SLD_2 RAWUL TBK1_ULD Motif Other DBs NCBI-ProteinID:  EJD48474 JGI:  41204 LinkDB All DBs AA seq 72 aa AA seqDB search LVMTASGRSTVLCMSASDTVLHIKQQLESRAGIPPDQSRLIFAGKELEDERTLDDYAIIE NCTVHHVRRLRG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt cttgtcatgacggcgagtgggcggtcgaccgtgctgtgcatgagcgcctcagacacagtc ctccacattaagcaacagctagaaagccgagcgggtataccccccgaccagtcgaggctc atctttgcgggcaaggaactggaggacgagcgcacgctcgatgactatgctatcatcgag aactgcactgtccatcacgttcgcagactgcgaggt

DBGET integrated database retrieval system