Auricularia subglabra: AURDEDRAFT_48066 Help Entry AURDEDRAFT_48066  CDS       T03129                                  Name (GenBank) histone H2B   KO K11252   histone H2B Organism adl  Auricularia subglabra Brite KEGG Orthology (KO) [BR:adl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:adl03036]     AURDEDRAFT_48066   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:adl04147]     AURDEDRAFT_48066 Chromosome and associated proteins [BR:adl03036]  Eukaryotic type   Nucleosome assembly factors    Histones     AURDEDRAFT_48066 Exosome [BR:adl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    AURDEDRAFT_48066 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-ProteinID:  EJD40176 JGI:  48066 UniProt:  J0WXY8 LinkDB All DBs AA seq 61 aa AA seqDB search QVVKRVHPDTGISNKAMAIQNSLASDIFERIATEASKLTSYSKKSTILSREIQTSVRLIL P NT seq 183 nt NT seq  +upstreamnt  +downstreamnt caggttgtgaaacgcgtacaccccgacacaggtatctccaacaaggccatggccatccag aactcactcgccagcgacatcttcgagcgcatcgccacggaggcctccaagctgacttcg tactcaaagaagtcgaccatcttgtcgcgcgaaatccagacgtcagtccgcctcatccta cca

DBGET integrated database retrieval system