Tsuneonella dongtanensis: A6F68_00243 Help Entry A6F68_00243       CDS       T04466                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ado  Tsuneonella dongtanensis Pathway ado01100   Metabolic pathways ado01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ado00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6F68_00243 (acpP_1)    00074 Mycolic acid biosynthesis     A6F68_00243 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6F68_00243 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5666 Motif Other DBs NCBI-ProteinID:  ANY18778 UniProt:  A0A1B2A9M4 LinkDB All DBs Position 269042..269284 Genome browser AA seq 80 aa AA seqDB search MDRAEVDARIRGLAEPFNKKEVAIDEDTSFAGDLEFDSLTVMDFVAAIEDEFDIIISMNQ QAEIETWGDLIDAVHETQSK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaccgtgcagaagtcgacgcccgcatccgcggtctcgccgaaccgttcaacaagaag gaagtcgcgatcgacgaggacacctcgttcgccggtgaccttgaattcgacagcctgacg gtgatggatttcgtcgccgcgatcgaggacgaattcgacatcatcatcagcatgaaccag caggccgagatcgagacctggggcgacctgatcgacgccgtgcacgagacgcagtccaaa tga

DBGET integrated database retrieval system