KEGG   Tsuneonella dongtanensis: A6F68_00613
Entry
A6F68_00613       CDS       T04466                                 
Symbol
petA
Name
(GenBank) Ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
ado  Tsuneonella dongtanensis
Pathway
ado00190  Oxidative phosphorylation
ado01100  Metabolic pathways
ado02020  Two-component system
ado04148  Efferocytosis
Module
ado_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:ado00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A6F68_00613 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6F68_00613 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    A6F68_00613 (petA)
Enzymes [BR:ado01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     A6F68_00613 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske DUF4704
Other DBs
NCBI-ProteinID: ANY19145
UniProt: A0A1B2AAR5
LinkDB
Position
complement(617525..618097)
AA seq 190 aa
MADTTGDAIPGTETVLDDGVRRRDFINIAAIGAAGVGGVSVLLPLISQMAPSADVLAESS
TEVDVSAIQPGQAIKAVFRKQPLFVRRLTPAEIEAANKIDVGSLRDPQTLEERTKEGHGD
VLVTMGVCTHLGCVPLGAAEGEVKGEFGGYFCPCHGSHYDTAARILKGPAPKNLEVPEYE
FTSDTVIKVG
NT seq 573 nt   +upstreamnt  +downstreamnt
atggctgatacgactggcgacgcgatcccggggaccgaaacggttctcgatgacggggtc
cggcggcgcgatttcatcaatatcgcggcgatcggcgcggcgggtgtcggcggcgtctcg
gtgcttctgcccctgatcagccagatggccccgtcggccgacgtgctcgccgagagcagc
accgaggtcgacgtgtcggcgatccagccggggcaggcgatcaaggcggtgttccgcaag
cagccgctgttcgtccgtcggctgaccccggcggagatcgaagcggccaacaagatcgac
gtcggttcgctgcgcgatccgcagacgctcgaggagcgcaccaaggaagggcacggcgac
gtgctcgtgacgatgggtgtctgcacccacctcggctgcgtgccgctgggtgccgccgag
ggcgaggtgaagggtgagttcggcgggtacttctgcccgtgccacggctcgcactacgat
accgcggcgcgcatcctgaagggtccggcaccgaagaacctcgaagtgcccgagtatgaa
ttcaccagcgacaccgtgatcaaggtcggctga

DBGET integrated database retrieval system