Tsuneonella dongtanensis: A6F68_02286 Help Entry A6F68_02286       CDS       T04466                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ado  Tsuneonella dongtanensis Pathway ado01100   Metabolic pathways ado01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ado00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A6F68_02286 (acpP_2)    00074 Mycolic acid biosynthesis     A6F68_02286 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A6F68_02286 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANY20786 UniProt:  A0A1B2AF82 LinkDB All DBs Position 2301624..2301914 Genome browser AA seq 96 aa AA seqDB search MTDGHHLAPSRASIDAKLRAIIADVLGLDAERVAGFDADTGLFGHLPELDSMAVAGLLTE MEDRLDIVIDDDDVDGEMLETYGGLLAFAEGKAVTT NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgactgacggccaccatctcgcccccagccgggcatcgatcgacgcgaagctgcgggcg atcattgccgacgttctcgggctcgacgcagagcgcgtcgccggcttcgacgccgacacc ggcctgttcgggcacctgcccgaactcgattcgatggcggtcgcgggcttgcttaccgag atggaagaccgtctcgacatcgtgatcgacgatgacgacgtcgatggcgagatgctcgag acctatggcggcctgctggcttttgccgagggcaaagccgtaacgacgtga

DBGET integrated database retrieval system