Arachis duranensis: 107464792 Help Entry 107464792         CDS       T04300                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism adu  Arachis duranensis Pathway adu04136   Autophagy - other Brite KEGG Orthology (KO) [BR:adu00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     107464792  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:adu04131]     107464792    04121 Ubiquitin system [BR:adu04121]     107464792    03029 Mitochondrial biogenesis [BR:adu03029]     107464792 Membrane trafficking [BR:adu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107464792 Ubiquitin system [BR:adu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107464792 Mitochondrial biogenesis [BR:adu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107464792 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  107464792 NCBI-ProteinID:  XP_015939248 UniProt:  A0A6P4C0V1 LinkDB All DBs Position 9:complement(12097926..12101468) Genome browser AA seq 94 aa AA seqDB search MAAESPSSVRKVVVHLRATGDAPILKQSKFKIAGADKFAKVIDFLRRQLHRETLFVYVNS AFSPNPDESIIDLYTNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgctgagtcaccaagttccgttcgtaaagtggttgttcatctgagagccactggt gatgctcctattctcaagcaatctaaattcaagatagcaggagctgataaatttgcaaag gtgatagactttcttagacggcaactccacagggaaacattgtttgtatatgtcaacagt gctttttcacccaatcctgatgaatcaatcattgatttgtatactaattttggttttgat ggcaaattggtggtcaactacgcatgttctatggcatggggctaa

DBGET integrated database retrieval system