Arachis duranensis: 107474060 Help Entry 107474060         CDS       T04300                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism adu  Arachis duranensis Brite KEGG Orthology (KO) [BR:adu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:adu03041]     107474060   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:adu04052]     107474060 Spliceosome [BR:adu03041]  Complex B   Other components    Complex B specific factors     107474060 Cytokines and neuropeptides [BR:adu04052]  Neuropeptides   Unclassified    107474060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 OTU1_UBXL Rad60-SLD Ubiquitin_4 Crinkler Motif Other DBs NCBI-GeneID:  107474060 NCBI-ProteinID:  XP_020991955 UniProt:  A0A6P5N570 LinkDB All DBs Position 1:complement(7648877..7649730) Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLKDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggttctaaacgatcgattggggaagaaggttcgcgtgaaatgcaacgat gacgacaccatcggagacctgaagaagctggttgcagctcagacaggaacgagggccgac aagattcgcatccagaagtggtacaccatctacaaggatcatatcaccctcaaagattac gagatccacgacggcatgggcctcgagctctactacaactaa

DBGET integrated database retrieval system