Arachis duranensis: 107486127 Help Entry 107486127         CDS       T04300                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism adu  Arachis duranensis Pathway adu03083   Polycomb repressive complex adu04120   Ubiquitin mediated proteolysis adu04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:adu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107486127    04120 Ubiquitin mediated proteolysis     107486127   09126 Chromosome    03083 Polycomb repressive complex     107486127  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:adu04131]     107486127    04121 Ubiquitin system [BR:adu04121]     107486127    03036 Chromosome and associated proteins [BR:adu03036]     107486127 Membrane trafficking [BR:adu04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     107486127 Ubiquitin system [BR:adu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      107486127    Cul7 complex      107486127 Chromosome and associated proteins [BR:adu03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      107486127   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      107486127 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 BTB DarP Cpf1_PI-like Motif Other DBs NCBI-GeneID:  107486127 NCBI-ProteinID:  XP_015962163 UniProt:  A0A6P4D4L8 LinkDB All DBs Position 4:114576235..114576739 Genome browser AA seq 156 aa AA seqDB search MGSPLKKIMLCSSEKEIFSVEEQVMVQHSVIINNMIEDGSYNHEESKIPLDCVDSKTLKK VIDYCTHHTHHHNDNQEDLEAWDAQFLNVDSNGLYDLLMAANYLEIRNLMDLIYRTIKNM IKGKKIDEIRRILNIKDHGFTPEEEEQNRKEYPHFY NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgggttcgccgttgaagaagatcatgctatgcagttcggaaaaggagattttcagtgtg gaagaacaagtgatggtacaacattctgtgatcataaacaacatgatcgaagatgggtcg tacaaccatgaagagagcaagattccattggattgcgttgactccaagactctcaagaag gtcatcgattattgtacacaccacactcaccaccacaacgacaaccaagaagatcttgag gcttgggatgctcaatttctcaatgttgattctaacggcctttatgatttgttgatggca gcaaattatcttgagattagaaatctcatggatctgatatacagaactataaaaaatatg ataaagggaaagaaaatagatgagatacgcagaatcttgaacattaaagatcatggcttc actcctgaggaggaagaacaaaatcgcaaggagtacccacatttttattag

DBGET integrated database retrieval system