Arachis duranensis: 107489318 Help Entry 107489318         CDS       T04300                                  Name (RefSeq) ras-related protein Rab7-like   KO K07897   Ras-related protein Rab-7A Organism adu  Arachis duranensis Pathway adu04142   Lysosome biogenesis adu04144   Endocytosis adu04145   Phagosome adu04148   Efferocytosis Brite KEGG Orthology (KO) [BR:adu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107489318    04145 Phagosome     107489318    04142 Lysosome biogenesis     107489318    04148 Efferocytosis     107489318  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:adu04131]     107489318   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:adu04147]     107489318    04031 GTP-binding proteins [BR:adu04031]     107489318 Membrane trafficking [BR:adu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107489318 Exosome [BR:adu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107489318   Exosomal proteins of other body fluids (saliva and urine)    107489318   Exosomal proteins of colorectal cancer cells    107489318   Exosomal proteins of bladder cancer cells    107489318 GTP-binding proteins [BR:adu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107489318 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107489318 NCBI-ProteinID:  XP_052117677 UniProt:  A0A9C6WJ57 LinkDB All DBs Position 5:49008942..49020560 Genome browser AA seq 115 aa AA seqDB search MRLFWQIWDTTGQERFNSLGAAFYRGADCCVLVYDVNAHNTFDTLNNWHDEFIKQADLND HKAFPFVLLGNKVDVDGGNSRKVTEKKAREWCASRGNLPYFCLIDTCVLIFLSLA NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgagactcttttggcagatttgggatacaacaggacaagaaaggttcaatagtttaggt gctgcattttatagaggtgcagattgttgtgttttggtgtatgatgtaaatgcacacaac acatttgacacactaaacaattggcatgatgagttcattaagcaggcagatttgaatgat cataaagcatttccctttgtgttacttgggaacaaggttgatgtagatggtgggaacagt agaaaggtgactgagaagaaagctagggaatggtgtgcttctagagggaacctaccatac ttttgtttaattgatacctgtgtactaatctttttgtcactggcatag

DBGET integrated database retrieval system