Arcobacter defluvii: ADFLV_2663 Help Entry ADFLV_2663        CDS       T06891                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism adz  Arcobacter defluvii Pathway adz01100   Metabolic pathways adz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:adz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ADFLV_2663 (acpP1)    00074 Mycolic acid biosynthesis     ADFLV_2663 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ADFLV_2663 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  QKF78636 UniProt:  A0AAE7E7W0 LinkDB All DBs Position 2678088..2678318 Genome browser AA seq 76 aa AA seqDB search MALLDDVKAVVVEQLDCDPAEVKEDSKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVADAIKYIENNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagcagtagttgttgagcaattagattgtgatccagca gaagtaaaagaagattcaaaattcattgaagatttaggtgctgattcactagatgtagtt gaacttgttatggctttagaagagaaatttgacattgaaatcccagatgaagatgctgaa aaaatcttaactgttgctgatgctataaaatacatcgaaaataacgcgtaa

DBGET integrated database retrieval system