Aeromonas sp. ASNIH3: C2U39_09305 Help Entry C2U39_09305       CDS       T05427                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism aea  Aeromonas sp. ASNIH3 Brite KEGG Orthology (KO) [BR:aea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aea03400]     C2U39_09305 DNA repair and recombination proteins [BR:aea03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     C2U39_09305 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI MinE Motif Other DBs NCBI-ProteinID:  AUV12354 LinkDB All DBs Position 1935930..1936184 Genome browser AA seq 84 aa AA seqDB search MRLEIIIDRKHQIPTSTMEALRQELLKQLGERFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPEEEALEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcgcctggaaatcatcatcgacagaaaacaccagatccccacctcgaccatggaggcc ttgcgccaggagctgctcaagcaactgggtgagcgctttcccgatctgcatgtgcgggtg gcaccgggtagtgccatggctctgacggtcagtcgcgccagcaaggaagacaaggagctg gccgaagccatggtgcaggaggtgtgggaaaacgccgatagctggatgccggaagaagag gctctggaggcctga

DBGET integrated database retrieval system