Aeromonas sp. ASNIH3: C2U39_09835 Help Entry C2U39_09835       CDS       T05427                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism aea  Aeromonas sp. ASNIH3 Brite KEGG Orthology (KO) [BR:aea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aea03032]     C2U39_09835    03036 Chromosome and associated proteins [BR:aea03036]     C2U39_09835    03400 DNA repair and recombination proteins [BR:aea03400]     C2U39_09835 DNA replication proteins [BR:aea03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C2U39_09835 Chromosome and associated proteins [BR:aea03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C2U39_09835 DNA repair and recombination proteins [BR:aea03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C2U39_09835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-DNA_bdg HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AUV12450 LinkDB All DBs Position 2061160..2061432 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIADGADISKAAAGRALDAFIDAVGEALKEGDQVALVGFGTFAVRERAARSG RNPQTGATIEIAAGKVPAFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgattgacaagattgcagacggtgctgatatctccaaagctgcc gctggtcgtgcgctggatgccttcatcgatgccgtgggcgaagccctgaaagagggtgac caggttgctctggttggtttcggtactttcgccgttcgcgagcgtgcagcccgttccggc cgcaacccgcaaactggtgcgactatcgaaatcgctgccggtaaagttcctgccttcaaa gccggcaaggccctgaaagacgcggtcaactaa

DBGET integrated database retrieval system