Aeromonas sp. ASNIH3: C2U39_10930 Help Entry C2U39_10930       CDS       T05427                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aea  Aeromonas sp. ASNIH3 Pathway aea01100   Metabolic pathways aea01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aea00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C2U39_10930    00074 Mycolic acid biosynthesis     C2U39_10930   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C2U39_10930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 EutQ HLH MAP Motif Other DBs NCBI-ProteinID:  AUV12629 LinkDB All DBs Position 2287183..2287419 Genome browser AA seq 78 aa AA seqDB search MSNIEERVKKIIIEQLGVKEEDVKNAASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYITANQE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacatcgaagaacgcgtaaagaaaatcatcatcgaacaactgggtgttaaagaa gaagacgtgaagaacgctgcctccttcgtcgacgacctgggcgctgactctttggatacc gttgaactggtaatggcgctggaagaagaattcgataccgaaattcctgatgaagaagcc gagaagatcaccactgttcaagcggctatcgactacatcaccgctaatcaggaataa

DBGET integrated database retrieval system