KEGG   Aeromicrobium sp. A1-2: C6I20_04220
Entry
C6I20_04220       CDS       T05642                                 
Name
(GenBank) PTS sugar transporter subunit IIA
  KO
K02798  mannitol PTS system EIIA component [EC:2.7.1.197]
Organism
aeb  Aeromicrobium sp. A1-2
Pathway
aeb00051  Fructose and mannose metabolism
aeb01100  Metabolic pathways
aeb02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:aeb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C6I20_04220
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C6I20_04220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aeb02000]
    C6I20_04220
Enzymes [BR:aeb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     C6I20_04220
Transporters [BR:aeb02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component
    C6I20_04220
SSDB
Motif
Pfam: PTS_EIIA_2
Other DBs
NCBI-ProteinID: AXT84478
LinkDB
Position
complement(861797..862240)
AA seq 147 aa
MADLLSRDAVQLAASASSAEEAIRITGGVLVDAGAVDPTYVDAMLAREQSVSTYMGEGFA
IPHGTVESKDTVRRDALSFVRFPDGVDWNGHDVRVAIGIAAIGDNHVGILSQLAMILVDP
DQARQLREASDVESVLRLLQPSEGDDS
NT seq 444 nt   +upstreamnt  +downstreamnt
atggctgacctgctcagccgcgacgccgtgcaactcgcggcatccgcgtcctccgccgag
gaggccatccggatcaccggtggcgtcctggtcgatgccggagcggtcgacccgacctac
gtcgacgcgatgctcgcccgtgagcagtccgtgtcgacctacatgggtgaaggcttcgcg
atcccccacggcacggtcgagagcaaggacaccgtccgccgcgatgcgctctcgttcgtg
cgcttccccgacggtgtcgactggaacgggcacgacgtccgggtcgcgatcggcatcgcc
gcgatcggcgacaaccacgtcggcatcctgtcccagctcgccatgatcctggtcgatcca
gaccaggcccgacagctccgcgaggcatccgacgtcgagtcggtcctccgtctgctgcaa
ccctccgaaggagacgactcatga

DBGET integrated database retrieval system