Aeromicrobium sp. A1-2: C6I20_14205 Help Entry C6I20_14205       CDS       T05642                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aeb  Aeromicrobium sp. A1-2 Pathway aeb01100   Metabolic pathways aeb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aeb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6I20_14205    00074 Mycolic acid biosynthesis     C6I20_14205   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6I20_14205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Dioxygenase_N Motif Other DBs NCBI-ProteinID:  AXT86221 LinkDB All DBs Position 2893872..2894129 Genome browser AA seq 85 aa AA seqDB search MSMGSPRSLASETINRFLVRAGKNTDVTPETSLYAEGLGLDSLETAELSSMLEDDLTRDP FSEGIMAATIGEILDFYSAEEPASA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatgggaagcccccgcagcctggcctcggagaccatcaaccgctttctcgtgagg gccggcaagaacacggacgtcacccccgagacgtcgctctatgccgaaggactcggcctg gactcgctggagacagccgagctgtcctcgatgctcgaggacgacctcaccagggacccg ttcagcgaaggcatcatggcggcgacgatcggcgagatcctcgatttctacagcgccgag gaacccgcctccgcgtga

DBGET integrated database retrieval system