Aeromicrobium sp. A1-2: C6I20_15175 Help Entry C6I20_15175       CDS       T05642                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism aeb  Aeromicrobium sp. A1-2 Brite KEGG Orthology (KO) [BR:aeb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aeb03032]     C6I20_15175    03036 Chromosome and associated proteins [BR:aeb03036]     C6I20_15175    03400 DNA repair and recombination proteins [BR:aeb03400]     C6I20_15175 DNA replication proteins [BR:aeb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C6I20_15175 Chromosome and associated proteins [BR:aeb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C6I20_15175 DNA repair and recombination proteins [BR:aeb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C6I20_15175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AXT86384 UniProt:  A0A3B7DEY1 LinkDB All DBs Position complement(3091569..3091847) Genome browser AA seq 92 aa AA seqDB search MAISRNDLVAALASKAGTSKAEADAVLSSFSEILLDSVSNGEKVSIPGILSVERVERAAR TGRNPSTGETIDIPAGFGVKVSVGSRLKAAAK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt gtggctatctcacgcaacgacctcgtcgctgccctcgcttcgaaggccggcaccagcaag gccgaggccgacgcagttctctcgtccttcagcgagatcctgctcgactccgtcagcaat ggcgagaaggtctcgatccccggcatcctgtccgtcgagcgtgtcgaacgcgccgcgcgc acgggtcgcaacccgtcgacgggcgagacgatcgacattcccgccggtttcggcgtcaag gtgagcgtcggctcgcgcctcaaggcagcggccaagtaa

DBGET integrated database retrieval system