KEGG   Acromyrmex echinatior (Panamanian leafcutter ant): 105153624
Entry
105153624         CDS       T03917                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
aec  Acromyrmex echinatior (Panamanian leafcutter ant)
Pathway
aec00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:aec00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    105153624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aec00199]
    105153624
Enzymes [BR:aec01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     105153624
Cytochrome P450 [BR:aec00199]
 Cytochrome P450, animal type
  CYP306 family
   105153624
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 105153624
NCBI-ProteinID: XP_011066880
LinkDB
Position
Unknown
AA seq 485 aa
MVAFLIFLGVFLIFLVYIFRKNRKTRRLPPGPSGIPLFGYLPWINSERPHMSFTELARKY
GPICGLQMGSVYTVLLSDPQLVRQTFAKDAFAGRAPLYLTHGIMQGYGLICAEGNLWKDQ
RRFVAGCLKNFGMTKLPGTKRDRLEERILVSVNECISKLKELTMEHIDPCETFHHYMGNI
MNDIVFGKVYKEDDAIWKWLRHVQEEGLKHIGIAGPLNFLPFFRFLPRYGKVMELLIDGK
LKTHQHYQTIIDEHRARPEKTDNFLAAFDDAMNTDANNEHFTQQQFYHLLADLYGAGVDT
TFATFRWFLLFMAAYPDEQKKIQDEMDELLGQKVPTLEDKLILIRLQAAIAETQRLRSIT
PVITNNDTQIGDYDIPKGTMIVPLQWAIHTDPSYWHDPLSFKSERFIAEDGSLIKPKAFL
PYQAGKRMCVGDELSRMTLFLFGARILHSFVLSVPSGMRLDLEGECGITLVPKSHRLIFT
PRIRE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggtagcctttttaattttcctcggcgtatttctcatatttcttgtctacatctttcgt
aaaaatcgcaaaacgcgtcgactaccaccgggaccatccggcatcccgttgtttggttat
ttaccatggataaattcggaacgtcctcatatgtcgttcacggaactggcgaggaaatat
ggtccgatttgtgggctacaaatgggttctgtatacacagtattgttatcggatccgcag
ctggtaaggcagaccttcgccaaggatgcgtttgccggccgggctccattatacttgacg
catggaattatgcagggatatggtcttatttgtgccgagggtaacctttggaaagaccaa
agaagatttgtagccggatgtctaaagaatttcggtatgacgaagttacccggcaccaag
agggacagactggaggaaagaatccttgtgagcgtgaacgagtgcatatcgaaactgaaa
gaactaactatggaacatattgatccatgcgagacgtttcatcattacatgggtaacata
atgaacgacatcgtgtttggtaaagtttacaaagaagatgatgcgatatggaaatggctg
agacatgtgcaagaagaaggactcaagcacattggaattgcagggccactcaactttttg
ccattcttcagatttttgccacgatatggcaaagtaatggagttacttatcgatggtaaa
ctaaaaacacatcaacattatcaaacaatcatcgacgagcatcgtgctcgaccagagaaa
acggataacttccttgcggcattcgacgatgcaatgaataccgatgcgaataatgaacac
ttcacacaacagcaattttatcatctactagccgacctttatggtgcaggcgttgatact
actttcgcaacctttcgttggttcctcctgttcatggcagcatatccggacgaacaaaaa
aaaattcaggatgaaatggacgagctgttgggacaaaaggtacccactctggaggacaag
ttaatcttaattcgactacaggcagccattgcggaaacgcaaagattgcggagcataaca
ccggtaataacaaataacgatacacaaataggcgattacgacataccgaaaggtaccatg
attgttccattgcaatgggctattcatacagatccttcgtactggcacgacccgctctcg
tttaaatccgagagatttattgctgaagacggaagtctcatcaagccgaaagcctttcta
ccgtatcaagcaggtaaacgtatgtgcgttggtgatgaattgtcgaggatgacattattt
ttattcggcgcaagaattcttcattcattcgttctctccgttccatccggcatgcgcctc
gatctggaaggcgagtgcggaattaccctggttccgaaatcacaccgcttaatttttaca
ccacgaataagagaataa

DBGET integrated database retrieval system