KEGG   Arsenophonus endosymbiont of Aphis craccivora: E3U36_02410
Entry
E3U36_02410       CDS       T07584                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
aed  Arsenophonus endosymbiont of Aphis craccivora
Pathway
aed03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aed00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    E3U36_02410 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aed03011]
    E3U36_02410 (rplR)
Ribosome [BR:aed03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    E3U36_02410 (rplR)
  Bacteria
    E3U36_02410 (rplR)
  Archaea
    E3U36_02410 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p Ribosomal_L5e AAA_26
Other DBs
NCBI-ProteinID: QLK87305
LinkDB
Position
complement(471097..471450)
AA seq 117 aa
MDKKVARIRRATRARRKLHELGATRLVVHRTPRHIYAQVIAPNGSETLVVASTTEKTINE
QVKYTGNKEAAAAVGKLIAERALEKGIKEVAFDRSGFQYHGRVQALADAAREAGLQF
NT seq 354 nt   +upstreamnt  +downstreamnt
atggataagaaagtagctcgtatccgtcgtgcgacccgcgcacgccgcaaactacatgaa
ctgggtgcaacgcgcttggtggtacaccgtacccctcgacatatttatgcgcaggttatt
gcaccaaacggttctgaaactttggtggttgcttctactacagaaaaaactatcaatgag
caagtaaagtacacaggaaacaaagaagcagcagcagcagttggtaaattaattgctgag
cgcgcgttggaaaaaggcatcaaagaagttgcttttgaccgttctggtttccaatatcat
ggtcgagtccaggcactggcagatgctgcccgtgaagctggccttcagttctaa

DBGET integrated database retrieval system