Anabaenopsis elenkinii: IM676_17440 Help Entry IM676_17440       CDS       T09787                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aee  Anabaenopsis elenkinii Pathway aee01100   Metabolic pathways aee01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aee00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IM676_17440 (acpP)    00074 Mycolic acid biosynthesis     IM676_17440 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IM676_17440 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF3924 Ribosomal_L50 HLH DUF5783 Motif Other DBs NCBI-ProteinID:  QOV22429 UniProt:  A0A7S6RCJ5 LinkDB All DBs Position 3981621..3981872 Genome browser AA seq 83 aa AA seqDB search MSETDIFEKVKKIVVEQLSVEEHKVNPGASFADDLGADSLDTVELVMALEEEFDIEIPDE AAEKITTIQQAVDYIKGKSAASA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagtgaaacagacatttttgaaaaggtcaagaaaattgttgtggagcaactaagtgtt gaagaacacaaagttaacccaggagctagttttgctgatgatctgggggctgattcccta gatacggtagaattggtgatggcattggaagaagaatttgatatcgaaattcccgatgag gccgccgaaaaaattactaccatccaacaggcagtagattacattaaaggaaaatctgct gcatcggcttaa

DBGET integrated database retrieval system