Aeromicrobium yanjiei: GEV26_12495 Help Entry GEV26_12495       CDS       T06272                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism aef  Aeromicrobium yanjiei Pathway aef00190   Oxidative phosphorylation aef01100   Metabolic pathways Module aef_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:aef00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     GEV26_12495 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:aef00194]     GEV26_12495 (atpE) Photosynthesis proteins [BR:aef00194]  Photosystem and electron transport system   F-type ATPase [OT]    GEV26_12495 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QGG42120 UniProt:  A0A5Q2MPP1 LinkDB All DBs Position complement(2547538..2547756) Genome browser AA seq 72 aa AA seqDB search MDGTLNGSVNMIGYGLAAIGPGIGIGLIFAAYINGVARQPEAQARLQAIAILGFALAEAL AIIGIALAFVLS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt gtggacggcactctcaacggctcagtgaacatgatcggctacggcctcgccgcgatcggt cctggcatcggcatcggcctgatcttcgccgcctacatcaacggcgtcgcacgtcagccc gaggcgcaggctcgcctgcaggcaatcgccattctgggcttcgccctcgcggaggcgctg gccatcatcggcatcgcgctcgccttcgtcctcagttga

DBGET integrated database retrieval system