Alkalilimnicola ehrlichii: Mlg_1420 Help Entry Mlg_1420          CDS       T00391                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aeh  Alkalilimnicola ehrlichii Pathway aeh01100   Metabolic pathways aeh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aeh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mlg_1420    00074 Mycolic acid biosynthesis     Mlg_1420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mlg_1420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 HLH Ribosomal_L50 Phage_tail_2 Motif Other DBs NCBI-ProteinID:  ABI56769 UniProt:  Q0A8R8 LinkDB All DBs Position complement(1626146..1626385) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEEEVSGEASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAVDYINKHLGS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcagcatcgaagaacgcgttaagaaaatcgtcgtcgagcagcttggggtcaaagag gaagaggtgagcggtgaggcctcctttgtcgacgatcttggcgctgactcgctggatacc gtggaactggtcatggcgctcgaggaggagttcgagtgcgaaattcctgacgaagaagct gagaagatcaccaccgttcaacaggcggtcgactacatcaacaagcatctgggctcctaa

DBGET integrated database retrieval system