Acinetobacter equi: AOY20_06315 Help Entry AOY20_06315       CDS       T04103                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism aei  Acinetobacter equi Pathway aei01100   Metabolic pathways aei01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aei00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AOY20_06315    00074 Mycolic acid biosynthesis     AOY20_06315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AOY20_06315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CRR7 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  ALH95180 UniProt:  A0A0N9VDH9 LinkDB All DBs Position 1351907..1352155 Genome browser AA seq 82 aa AA seqDB search MLTQEEVLEKLREWMEDLFEISPEDIQLDSNLATDLDVDSIDAIDLVVKIKELTGKQVNP EDFKSVRTIQDVVIVIQNMTVE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgctgactcaagaagaagttctcgaaaagttaagagagtggatggaagatctatttgaa atttcaccagaagatattcagttggattcaaatttagcaactgatttagatgtagatagt attgatgctattgatttggtagtaaaaattaaagaactgacgggaaaacaagttaatcct gaagattttaaaagtgtaagaaccattcaggatgttgttattgttattcaaaatatgaca gttgaatga

DBGET integrated database retrieval system