Aeromonas sp. 2692-1: E5E97_09970 Help Entry E5E97_09970       CDS       T08798                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism aej  Aeromonas sp. 2692-1 Brite KEGG Orthology (KO) [BR:aej00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:aej03110]     E5E97_09970 Chaperones and folding catalysts [BR:aej03110]  Protein folding catalysts   Protein disulfide isomerase    E5E97_09970 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 Thioredoxin_4 GST_N_2 Thioredoxin_2 GST_N Thioredoxin_3 Utp25_C Motif Other DBs NCBI-ProteinID:  QJT15676 LinkDB All DBs Position 2037711..2037947 Genome browser AA seq 78 aa AA seqDB search MKALKNVVIYTKDHCPFCARVKNYLTAEKVDFKQIRVDDDPKTYLELKERTNLQTVPQVF VDGEFIGSATDFFSWIDS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaaagcacttaagaatgttgttatttatacgaaagaccattgtccattttgcgcacgc gtgaagaattacctaactgctgaaaaggtcgatttcaaacaaattcgcgtagacgacgat ccgaagacttacctggagttgaaggaaagaacaaatctccaaactgtaccgcaagttttt gtggatggagaattcattggtagtgctacagacttcttctcgtggattgatagctaa

DBGET integrated database retrieval system