Aeromonas sp. 2692-1: E5E97_12185 Help Entry E5E97_12185       CDS       T08798                                  Name (GenBank) DUF3283 family protein   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism aej  Aeromonas sp. 2692-1 Pathway aej03030   DNA replication aej03430   Mismatch repair aej03440   Homologous recombination Brite KEGG Orthology (KO) [BR:aej00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     E5E97_12185    03430 Mismatch repair     E5E97_12185    03440 Homologous recombination     E5E97_12185  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:aej03032]     E5E97_12185    03400 DNA repair and recombination proteins [BR:aej03400]     E5E97_12185 Enzymes [BR:aej01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      E5E97_12185 DNA replication proteins [BR:aej03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      E5E97_12185 DNA repair and recombination proteins [BR:aej03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      E5E97_12185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF3283 DNA_pol3_theta Lyase_8_C Motif Other DBs NCBI-ProteinID:  QJT13602 LinkDB All DBs Position 2510770..2510934 Genome browser AA seq 54 aa AA seqDB search MSHNLCALPKEQQERVEVEKAAAYAVWKERNGQLAVVVSEPKPRQERVRERVVW NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atgagtcacaatctgtgtgccctaccgaaagagcagcaagaacgggtcgaggtcgagaag gccgccgcatatgcggtatggaaggagcgcaacggccagctggccgtggtcgtgagtgag ccaaaaccacgccaagagagagttcgggagcgggtggtgtggtaa

DBGET integrated database retrieval system