Aeromonas sp. 2692-1: E5E97_14790 Help Entry E5E97_14790       CDS       T08798                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism aej  Aeromonas sp. 2692-1 Brite KEGG Orthology (KO) [BR:aej00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aej03400]     E5E97_14790 DNA repair and recombination proteins [BR:aej03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     E5E97_14790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI Motif Other DBs NCBI-ProteinID:  QJT14065 LinkDB All DBs Position 3075446..3075694 Genome browser AA seq 82 aa AA seqDB search MRLEIIIDKKHQVPTSTMEALRQELLKQLGEKFPDLHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENADSWMPESVAS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgtctggaaatcatcatcgacaaaaaacatcaggtgcccacctcgaccatggaggcg ctgcgtcaggagctgctcaagcaactgggcgagaagttccccgacctgcatgtgcgggtc gcccccggcagcgccatggcgctgacggtcagccgcgcaagcaaggaggacaaggagctg gcagaagccatggtgcaggaggtgtgggagaatgccgacagctggatgccggagagtgtt gcctcctga

DBGET integrated database retrieval system