Aeromonas encheleia: NCTC12917_01361 Help Entry NCTC12917_01361   CDS       T06531                                  Symbol cysM_1 Name (GenBank) cysteine synthase B   KO K01738   cysteine synthase [EC:2.5.1.47] Organism ael  Aeromonas encheleia Pathway ael00270   Cysteine and methionine metabolism ael00920   Sulfur metabolism ael01100   Metabolic pathways ael01110   Biosynthesis of secondary metabolites ael01120   Microbial metabolism in diverse environments ael01200   Carbon metabolism ael01230   Biosynthesis of amino acids ael01320   Sulfur cycle Module ael_M00021   Cysteine biosynthesis, serine => cysteine Brite KEGG Orthology (KO) [BR:ael00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     NCTC12917_01361 (cysM_1)   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     NCTC12917_01361 (cysM_1) Enzymes [BR:ael01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.47  cysteine synthase      NCTC12917_01361 (cysM_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PALP Motif Other DBs NCBI-ProteinID:  VEG95815 LinkDB All DBs Position 1:1414620..1414898 Genome browser AA seq 92 aa AA seqDB search MAFATLDSLIGNTPLLRLQRINPHSRVTLLVKLEGNNPAGSVKDRPALNLIKAAEASGRL LPGARLIEATSGNTGIALAMVAAARGYKMRAT NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccttcgccaccctggacagtctgatcggcaataccccgttgctgcgtctgcagcgc atcaatccccattcaagggtgacgctgctggtgaagctggagggcaacaaccccgccggc tcggtcaaggacaggccggccctgaacctcatcaaggcggcggaggcgagtggccgcttg ctgccaggcgcgcggctcattgaggccacctccggcaacaccggcatagccctggccatg gtggcggcggcccgagggtacaagatgcgagcaacatga

DBGET integrated database retrieval system