KEGG   Aeromonas encheleia: NCTC12917_01837
Entry
NCTC12917_01837   CDS       T06531                                 
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
ael  Aeromonas encheleia
Brite
KEGG Orthology (KO) [BR:ael00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    NCTC12917_01837 (clpS)
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: VEG96281
LinkDB
Position
1:1959910..1960227
AA seq 105 aa
MSKQKELFANEEIAQAEKTKLQPPPMYKVVLNNDDYTPMEFVVEVLQKFFGMDLDKATQV
MLSVHYSGKGVCGTFTAEIAETKVVQVNTYSRNNEHPLLCTMEKA
NT seq 318 nt   +upstreamnt  +downstreamnt
atgagcaagcagaaagaactctttgctaatgaagagattgcacaagcagagaaaacgaag
ctgcaaccgccacccatgtacaaggtcgtgttgaacaacgatgactatacgccgatggag
ttcgtggtggaggtgctgcaaaagttctttggtatggatctggacaaggcgactcaggtc
atgttgagtgtgcattatagtggtaagggagtctgcggcactttcaccgccgagattgcc
gaaaccaaggtggtccaggtcaacacttattcacgtaacaacgaacatccactgctatgt
accatggaaaaggcttga

DBGET integrated database retrieval system