Aeromonas sp. CU5: CK911_05510 Help Entry CK911_05510       CDS       T05327                                  Name (GenBank) DinI family protein   KO K12149   DNA-damage-inducible protein I Organism aem  Aeromonas sp. CU5 Brite KEGG Orthology (KO) [BR:aem00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:aem03400]     CK911_05510 DNA repair and recombination proteins [BR:aem03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     CK911_05510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI YciZ Ubiq_cyt_C_chap Motif Other DBs NCBI-ProteinID:  ATL92326 UniProt:  A0A291TGQ6 LinkDB All DBs Position 1233872..1234123 Genome browser AA seq 83 aa AA seqDB search MRLEIIIDRKHQIPTLTMEALRQELLKQLGEKFPDIHVRVAPGSAMALTVSRASKEDKEL AEAMVQEVWENAESWMPEENVPS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgcgtcttgaaatcatcatcgatagaaaacaccagatcccgaccttgaccatggaggcg ctgcgtcaggagctgctcaagcagcttggtgagaagtttcccgacatccacgtgcgggtt gcccccggcagcgccatggccctgaccgtcagccgtgccagcaaagaagacaaagagctg gctgaagccatggtgcaggaagtgtgggagaacgccgagagctggatgccggaagagaac gtcccatcctga

DBGET integrated database retrieval system