Aeromonas salmonicida O23A: O23A_p3833 Help Entry O23A_p3833        CDS       T04990                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism aeo  Aeromonas salmonicida O23A Pathway aeo01100   Metabolic pathways aeo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aeo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O23A_p3833    00074 Mycolic acid biosynthesis     O23A_p3833   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O23A_p3833 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ARW84570 UniProt:  A0AAQ1AHS0 LinkDB All DBs Position 4073250..4073480 Genome browser AA seq 76 aa AA seqDB search MNDLIALVRQQFPQASINEQAALGLGSFPEWDSLGHFNLLLLIEQHFAVRFEPQELAELK SLADIRQALLRKGVAE NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaatgacctcatcgcgctggttcgccagcaatttccccaggccagcatcaacgagcag gccgccctcggcctcggcagctttcccgagtgggactctctgggacacttcaatctgctg ctgctcatcgagcagcactttgccgtgcggttcgaaccgcaggagctggccgagctgaag agcctggccgatatcagacaggctctgctacgcaaaggagttgccgagtga

DBGET integrated database retrieval system