Altererythrobacter epoxidivorans: AMC99_00725 Help Entry AMC99_00725       CDS       T04070                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism aep  Altererythrobacter epoxidivorans Pathway aep01100   Metabolic pathways aep01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aep00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMC99_00725    00074 Mycolic acid biosynthesis     AMC99_00725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMC99_00725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ALE16030 UniProt:  A0A0M4MFM7 LinkDB All DBs Position 684900..685136 Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggcgttgaggct gacaaggtcacccaggaagccagcttcatcgacgatcttggcgcagacagcctcgacatc gtcgagctggtgatggcattcgaagaagaattcggtgtcgaaatccccgacgatgcggct gaaaagatcgcaaccgtcggcgatgcgaccaagtacatcgaagaacacaagggctaa

DBGET integrated database retrieval system