KEGG   Adlercreutzia equolifaciens: AEQU_0952
Entry
AEQU_0952         CDS       T02875                                 
Name
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
  KO
K00184  dimethyl sulfoxide reductase iron-sulfur subunit
Organism
aeq  Adlercreutzia equolifaciens
Pathway
aeq00920  Sulfur metabolism
aeq01100  Metabolic pathways
aeq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aeq00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AEQU_0952
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aeq02000]
    AEQU_0952
Transporters [BR:aeq02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   AEQU_0952
SSDB
Motif
Pfam: Fer4_11 Fer4_6 Fer4_7 Fer4 Fer4_2 Fer4_10 Fer4_9 Fer4_8 Fer4_17 Fer4_4 Fer4_21 Fer4_ETF_QO Fer4_3 Fer4_15 Fer4_16
Other DBs
NCBI-ProteinID: BAN76921
LinkDB
Position
1238556..1239173
AA seq 205 aa
MTRLAIAINLDRCVGCHTCALSCKMQNNVPEGMLWNRVLTEDCDVMDGALGTYPNVTRTF
LPVACQHCQNAACQRVCPTGATYKDDKGRVEIDYDKCIGCRMCMAACPYNARNFNWQTPM
RVTGANYGDAEVPVRPKGVAEKCTLCKERTDRGEEPMCVVCCPAHARIFGDLDDPDSEIS
QTILNRKAWTLLEGQGTRPSVHYFE
NT seq 618 nt   +upstreamnt  +downstreamnt
atgaccagactagccattgccatcaacctcgaccggtgcgtcggctgccacacctgcgcc
ctgtcgtgcaagatgcagaacaacgtgcccgagggaatgctgtggaaccgcgtgctcacc
gaggactgcgacgttatggacggcgcgctcggcacctatcccaacgtgacgcgcacgttt
ctgcccgtggcctgccagcactgccagaacgcggcgtgccagcgcgtgtgccccaccggc
gccacctacaaggacgacaagggccgcgtggagatcgactacgacaagtgcatcggctgc
cgcatgtgcatggccgcctgcccctacaacgcgcgcaacttcaactggcagacgccgatg
cgcgtgacgggcgccaactacggcgatgccgaggtgccggtgcgtcccaagggcgtggcc
gagaagtgcaccttgtgcaaggagcgcaccgaccgcggcgaggagcccatgtgcgtcgtg
tgctgcccggcccatgcgcgcatcttcggcgacttggacgatccggacagcgagatttcc
cagaccattctgaaccgcaaggcgtggacgctcctggaaggccagggcacccgtccgtcc
gttcactacttcgaatag

DBGET integrated database retrieval system