Aeromicrobium erythreum: AERYTH_05915 Help Entry AERYTH_05915      CDS       T04236                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism aer  Aeromicrobium erythreum Brite KEGG Orthology (KO) [BR:aer00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     AERYTH_05915 Enzymes [BR:aer01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      AERYTH_05915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 Glrx-like GST_N_2 Thioredoxin_2 Thioredoxin DUF3088 GST_N Motif Other DBs NCBI-ProteinID:  ALX04270 UniProt:  A0A0U4C8U0 LinkDB All DBs Position complement(1235944..1236186) Genome browser AA seq 80 aa AA seqDB search MTGDFTLYSTPWCGYCHRLKSQLQREGISFEEVDIEQVPEAAAIVEKANNGNQTVPTLVF ADGTALTNPSVAQVKAQLGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaccggcgacttcaccctctactcgaccccgtggtgcggctactgccaccggctgaag tcgcagctccagcgcgagggcatcagcttcgaggaggtcgacatcgagcaggtccccgag gccgcggcgatcgtcgagaaggccaacaacggcaaccagacggtccccaccctggtgttc gccgacggcaccgccctcacgaacccgtccgtcgcgcaggtcaaggcccagctgggcgtc tga

DBGET integrated database retrieval system