Aeromicrobium erythreum: AERYTH_08920 Help Entry AERYTH_08920      CDS       T04236                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism aer  Aeromicrobium erythreum Pathway aer03060   Protein export aer03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:aer00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AERYTH_08920  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AERYTH_08920  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:aer02044]     AERYTH_08920 Secretion system [BR:aer02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AERYTH_08920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALX04811 UniProt:  A0A0U4C9X6 LinkDB All DBs Position complement(1889599..1889862) Genome browser AA seq 87 aa AA seqDB search MFRQIGPTEILLILGVVLLLFGGRKLPELARGSGRALRIFKSEVKELKDDEKPSHDLDGE VVDDSGARTEATTRSEQLRRDGTSEQA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgttcaggcagatcggccccacggagatccttctcatcctcggcgtggtcctgctgctg ttcggaggccgcaagctccctgagctcgcccgtggctccggacgcgcgctccgcatcttc aagtccgaggtcaaggagctcaaggacgacgagaagccgtcccacgacctcgacggcgag gtcgtcgacgactccggcgcgcggaccgaggcaaccacccgctccgagcagctgcgccgc gacggcacgtccgagcaggcgtaa

DBGET integrated database retrieval system