Aeromonas sp. 1805: E5E96_04490 Help Entry E5E96_04490       CDS       T10912                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism aerz  Aeromonas sp. 1805 Pathway aerz02024   Quorum sensing aerz03018   RNA degradation Brite KEGG Orthology (KO) [BR:aerz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     E5E96_04490 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     E5E96_04490 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:aerz03019]     E5E96_04490 (hfq)    03036 Chromosome and associated proteins [BR:aerz03036]     E5E96_04490 (hfq) Messenger RNA biogenesis [BR:aerz03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      E5E96_04490 (hfq) Chromosome and associated proteins [BR:aerz03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     E5E96_04490 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Iec3-like_M Motif Other DBs NCBI-ProteinID:  QJT16617 LinkDB All DBs Position 943470..943832 Genome browser AA seq 120 aa AA seqDB search MTTESPSYSTIEQAFSLGNGQDSALNWLRKNRSQVAIFLVSGIKLEGTISGFDQYSVLLT DAHGNQQLVYKAKISTIAMHSGRPQVSIQRARKPRVSMAPRPHGAPGRYDDNQGGGSSEQ NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgacaactgaatccccaagctactccacgattgagcaagccttctccctcgggaacggg caagattctgccctcaactggttgcgcaagaatcgcagtcaggtcgccatcttcttggtg agcggcatcaagctggaggggaccatcagcggtttcgaccagtacagcgtgctgttgacc gatgcccacggcaaccagcagctggtctacaaggccaagatttccaccatcgccatgcac tccggccggccgcaggtcagcatccagcgtgcccgcaaaccccgcgtctccatggcgccg cgcccccacggcgcgcccggtcgttatgacgacaaccagggcggcggtagcagcgagcag taa

DBGET integrated database retrieval system